Protein Info for HSERO_RS10545 in Herbaspirillum seropedicae SmR1

Annotation: protein disaggregation chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 861 TIGR03346: ATP-dependent chaperone protein ClpB" amino acids 6 to 859 (854 residues), 1419.2 bits, see alignment E=0 PF02861: Clp_N" amino acids 17 to 68 (52 residues), 51.2 bits, see alignment 9.2e-17 amino acids 94 to 145 (52 residues), 42 bits, see alignment 7e-14 PF00004: AAA" amino acids 203 to 335 (133 residues), 49.1 bits, see alignment E=6.3e-16 amino acids 607 to 725 (119 residues), 40.3 bits, see alignment E=3.4e-13 PF17871: AAA_lid_9" amino acids 342 to 442 (101 residues), 118.1 bits, see alignment E=1.3e-37 PF07724: AAA_2" amino acids 601 to 764 (164 residues), 237 bits, see alignment E=9.3e-74 PF00158: Sigma54_activat" amino acids 605 to 724 (120 residues), 24.3 bits, see alignment E=1.8e-08 PF07728: AAA_5" amino acids 606 to 741 (136 residues), 50.7 bits, see alignment E=1.5e-16 PF10431: ClpB_D2-small" amino acids 770 to 850 (81 residues), 87.7 bits, see alignment E=3.3e-28

Best Hits

Swiss-Prot: 75% identical to CLPB_RALSO: Chaperone protein ClpB (clpB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03695, ATP-dependent Clp protease ATP-binding subunit ClpB (inferred from 78% identity to aav:Aave_1249)

MetaCyc: 68% identical to protein disaggregase ClpB (Escherichia coli K-12 substr. MG1655)
RXN185E-10

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IT51 at UniProt or InterPro

Protein Sequence (861 amino acids)

>HSERO_RS10545 protein disaggregation chaperone (Herbaspirillum seropedicae SmR1)
MRLDKLTTKLQEALADAQSQAVGHDNQYIEPVHLILALLNQEDGGARSLLQRAGVNVNGL
SAALQAAVKRLPQVSGNGGEVQVGRELVALLNLADKEAQKHGDQFVASEMVLLGLVDDKS
DAGRAARENGLTRKSLEAAITAVRGGASVSSQQDEGQREALKKYTLDLTERARAGKLDPV
IGRDDEIRRAIQVLQRRSKNNPVLIGEPGVGKTAIVEGLAQRIVNGEVPDSLKSKRVLSL
DMAALLAGAKYRGEFEERLKAVLKEIAQDEGQTIVFIDELHTMVGAGKAEGAMDAGNMLK
PALARGELHCVGATTLDEYRQYIEKDAALERRFQKILVDEPSVEATIAILRGLQEKYEVH
HGVDITDPAIVAAAELSHRYITDRFLPDKAIDLIDEAASKIKIEIDSKPEVMDKLDRRLI
QLKIEREAVKREKDEASQKRLQLIEEEIEKLEREYADLEEIWKAEKSSAQGGQQLKEEIE
KVRLQMEEATRKSDWQKVSELKYGKLAELEAALEVQNKKDAAGVKTEKPKLVRTQVGAEE
IAEIVARATGIPVSRMMQGEREKLLHMEDVLHERVVGQDEAIVAVSDAIRRSRAGLGDPS
KPYGSFMFLGPTGVGKTELCKALASYLFDTEEAMIRIDMSEFMEKHSVARLIGAPPGYVG
YEEGGYLTEAVRRKPYSVILLDEIEKAHPDVFNVLLQVLDDGRMTDGQGRTVDFKNTVIV
MTSNLGSHKIQSMEDSDPALVKLAVMAEVRTHFRPEFINRVDEIVVFHALDAKNIGAIAK
IQLRILEQRLAKLEIGLEISEAGLQKIAEAGFDPVYGARPLKRAIQQEIENPLSKQILAG
KFGPKDVVRVDVDHGQLSFSK