Protein Info for HSERO_RS10540 in Herbaspirillum seropedicae SmR1

Annotation: camphor resistance protein CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 53 (25 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 95 to 119 (25 residues), see Phobius details PF02537: CRCB" amino acids 4 to 116 (113 residues), 99.4 bits, see alignment E=6.9e-33 TIGR00494: protein CrcB" amino acids 4 to 116 (113 residues), 97 bits, see alignment E=4.6e-32

Best Hits

Swiss-Prot: 62% identical to CRCB_CUPMC: Putative fluoride ion transporter CrcB (crcB) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K06199, CrcB protein (inferred from 100% identity to hse:Hsero_2109)

MetaCyc: 44% identical to F- channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-498

Predicted SEED Role

"CrcB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IT50 at UniProt or InterPro

Protein Sequence (124 amino acids)

>HSERO_RS10540 camphor resistance protein CrcB (Herbaspirillum seropedicae SmR1)
MGWLAVGMGATLGAWLRWRISVVWNVSGHFVPLGTLAANWIGAYVIGFLVAYFEQHPGLP
PEWRLFAVTGFLGGLTTFSTFSAEAMILLQRGDYLWAIGHSGLHLLGSIVLCVAGFASYR
ALAG