Protein Info for HSERO_RS10525 in Herbaspirillum seropedicae SmR1

Annotation: fusaric acid resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 734 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 395 to 415 (21 residues), see Phobius details amino acids 422 to 439 (18 residues), see Phobius details amino acids 447 to 467 (21 residues), see Phobius details amino acids 473 to 491 (19 residues), see Phobius details amino acids 496 to 517 (22 residues), see Phobius details amino acids 528 to 547 (20 residues), see Phobius details PF04632: FUSC" amino acids 26 to 715 (690 residues), 684 bits, see alignment E=2.8e-209 PF13515: FUSC_2" amino acids 39 to 167 (129 residues), 39.6 bits, see alignment E=5.7e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2106)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IT47 at UniProt or InterPro

Protein Sequence (734 amino acids)

>HSERO_RS10525 fusaric acid resistance protein (Herbaspirillum seropedicae SmR1)
MSNPALPFKAKLREAAADWWRSDAPTWVYVFKMVLAGLLALGIGYGLDLESPRSALITVF
IVMQPQSGMILAKSFYRVIGTLVGSMAIVVFVGLFAQTPELFLLASALWIGLCTVGSAHN
RNFRSYGFVLSGYTVALIGLPAALHPAITFDSVMTRVTEIMVGIVCVGLVSALVFPQASA
PGLVRIIRGRFTAFVDLISATLGGSADRKQLEATNARFVGDIIGLEAMRSAAIFEDPEVR
LRSGRLTRMNSEFMALSTRMHALHQLMNRLHANPAASAQVVIDAISPYFREVQPLLTRAS
GEPVMSALDAADAALKLDAYKRELPRRVRATRSTLAGQCQSDSAMLDFDTASELLYRVIE
ELHAYTLTYASMTQRHHEREQWEHSYAPKTSMTTALIAGARAAVVMLCLAGFWIASGWPS
GDVAVLNAAAFCAITSAAPDPAKATRTVAIGVLFAAVAGYVYTFHILPRLDGYWMLASAL
MPVLMLAVYLTTKPKWAGYGLGICIFFPFLAVPDNFAHFNAAGYLNESVALVVSLLVTAV
AFMVLLPPTTDWTVRVLEKQLRKQVVDACFGKLAHLALKFESGTRDLMHQITMFTTSRPL
LRQKALGWMFATLEVGHAIIELRNELHGIRTEAPDLLPASAYAALNRLREAIPALFAQPS
ATTLASALAANDATIAEVQTAIGPHYRERSERHRLQRTLSYLHFIRTALLDEQSPLHTMR
AGATNNTTGERHAT