Protein Info for HSERO_RS10175 in Herbaspirillum seropedicae SmR1

Annotation: flagellar basal body P-ring biosynthesis protein FlgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details PF17656: ChapFlgA_N" amino acids 54 to 128 (75 residues), 77 bits, see alignment E=1.7e-25 TIGR03170: flagella basal body P-ring formation protein FlgA" amino acids 118 to 252 (135 residues), 118.1 bits, see alignment E=1.4e-38 PF13144: ChapFlgA" amino acids 131 to 249 (119 residues), 91 bits, see alignment E=9.2e-30 PF08666: SAF" amino acids 132 to 191 (60 residues), 45.4 bits, see alignment E=1.5e-15

Best Hits

KEGG orthology group: K02386, flagella basal body P-ring formation protein FlgA (inferred from 100% identity to hse:Hsero_2032)

Predicted SEED Role

"Flagellar basal-body P-ring formation protein FlgA" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ISX3 at UniProt or InterPro

Protein Sequence (254 amino acids)

>HSERO_RS10175 flagellar basal body P-ring biosynthesis protein FlgA (Herbaspirillum seropedicae SmR1)
MSPWDKLLKMKHPLRVLRHACAALALLAGGLLALSPASAQNDPTAPQRQDLQIVQQTAEQ
FLKAQTAGLPGSITIQTDPIDQRMMLPACLDPQAFMPNGARLWGRTSVGVKCVAPAPWTI
YVRANVQVISDYLIAAVPLAQGQTISASDISRVRGDMSALPAGVITEESQVIGRVAGMSL
RAGTPLRMDAIRNQRVVQQGQSVRVVSNGPGFQISTEARALSNANEGQMTQARTAAGQVV
SGIAKAGGILEINY