Protein Info for HSERO_RS10090 in Herbaspirillum seropedicae SmR1
Annotation: oxidoreductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 44% identical to YFJR_BACSU: Uncharacterized oxidoreductase YfjR (yfjR) from Bacillus subtilis (strain 168)
KEGG orthology group: None (inferred from 100% identity to hse:Hsero_2016)Predicted SEED Role
"2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Photorespiration (oxidative C2 cycle) (EC 1.1.1.60)
MetaCyc Pathways
- superpathway of D-glucarate and D-galactarate degradation (5/5 steps found)
- D-glucarate degradation I (4/4 steps found)
- D-galactarate degradation I (4/4 steps found)
- glycolate and glyoxylate degradation I (3/4 steps found)
- superpathway of glycol metabolism and degradation (5/7 steps found)
- superpathway of microbial D-galacturonate and D-glucuronate degradation (16/31 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.1.1.60
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See D8ISH2 at UniProt or InterPro
Protein Sequence (282 amino acids)
>HSERO_RS10090 oxidoreductase (Herbaspirillum seropedicae SmR1) MGFPMAANLVRAGYAVRAWNRSPAPVERLAALGAQAAATPAEAAADADVLISMLADDDAT ETSLLDAGALAALRPGAIHVNMATISVALALRLAGLHQARGVAYVAAPVLGRVNVAEAGQ LNILAAGEEQALAAVQPLLDVLGQKTWRLGRQPEQANAAKLAMNFMIASAIGAMSEAVAL VQGYGLDKAGFIELATSTAFAAPVYKGYGQAIADDRFEPAGFKLALGLKDVRLALEAGEQ AHVPLSLASALRDLHIDGLAHGEGHLDWAALSRASARRAGQA