Protein Info for HSERO_RS09945 in Herbaspirillum seropedicae SmR1

Annotation: sugar transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF02563: Poly_export" amino acids 23 to 98 (76 residues), 75.2 bits, see alignment E=3.7e-25 TIGR03028: polysaccharide export protein EpsE" amino acids 26 to 264 (239 residues), 325.5 bits, see alignment E=8.4e-102 PF10531: SLBB" amino acids 105 to 155 (51 residues), 28.1 bits, see alignment 1.5e-10 amino acids 190 to 240 (51 residues), 46.4 bits, see alignment 2.8e-16

Best Hits

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 100% identity to hse:Hsero_1990)

Predicted SEED Role

"Capsular polysaccharide biosynthesis/export periplasmic protein WcbA; Capsular polysaccharide export system protein KpsC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ISE7 at UniProt or InterPro

Protein Sequence (264 amino acids)

>HSERO_RS09945 sugar transporter (Herbaspirillum seropedicae SmR1)
MRKILLMLAGLLVAVLAFSGSARAEDIPLGPGDVIRINVYGSQDLTLETRISEAGVISYP
LIGEVKIGGMSTAQAERKIAGMLKQGGYLVNPQVNILVTAPASQMISVLGQVYKPGRYPL
DGRRNVADVIALAGGVNPDGGDTITIVRTEDGKVTRTAVDIYAITHNGDTTELPTVGAND
VVYVERYQRFYIYGEVQRPGAYKLERGTTVLQALTLGGGLTPRGTERGLKVKRRDANGEL
QEISVKKDDLLLPDDIVYVKESWF