Protein Info for HSERO_RS09730 in Herbaspirillum seropedicae SmR1

Annotation: glycoside hydrolase family 43

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF16576: HlyD_D23" amino acids 47 to 294 (248 residues), 47.5 bits, see alignment E=2.9e-16 PF13533: Biotin_lipoyl_2" amino acids 50 to 95 (46 residues), 28.6 bits, see alignment 2e-10 PF13437: HlyD_3" amino acids 216 to 315 (100 residues), 54.5 bits, see alignment E=3.4e-18

Best Hits

Swiss-Prot: 47% identical to YHII_ECOLI: Uncharacterized protein YhiI (yhiI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1950)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ISB0 at UniProt or InterPro

Protein Sequence (358 amino acids)

>HSERO_RS09730 glycoside hydrolase family 43 (Herbaspirillum seropedicae SmR1)
MNRSLQHPLFAGLLLVVLAAVGWTGWAWWRDADAPAGLVSSNGRLEATEVDIGSRLGGRI
RHMLVDEGEAVQAGQVLAYLQVDSLHAQLREARAQQQRASQGVTVAQAQLAMRRSEQRIA
QALTVQRHKSLSAATRRVERSQPLGRMQALTAQEVDDEENTLAEARAQLDAAQAQEEGAR
AAIRAAEADVASARALLEAAQAATARIEADLEESAIRAPRDGHIQYRLAQAGEVVSEGSK
LLNLIDLSDLHMHFFLPAELAGKVRLGQEVRVVLDAAPTDALPARITYVSRQAQFTPKAV
ETANERQKLMFRVKAQLTPSSRGSIAPHLKAGMPGVAWIKTAEQLPWPKTLPAPGQSP