Protein Info for HSERO_RS09720 in Herbaspirillum seropedicae SmR1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 transmembrane" amino acids 23 to 41 (19 residues), see Phobius details amino acids 176 to 200 (25 residues), see Phobius details amino acids 221 to 244 (24 residues), see Phobius details amino acids 257 to 281 (25 residues), see Phobius details amino acids 288 to 306 (19 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 9 to 315 (307 residues), 58.1 bits, see alignment E=1.3e-19 PF12698: ABC2_membrane_3" amino acids 27 to 364 (338 residues), 115 bits, see alignment E=6.3e-37 PF01061: ABC2_membrane" amino acids 187 to 330 (144 residues), 81.9 bits, see alignment E=7.2e-27

Best Hits

Swiss-Prot: 53% identical to YHHJ_SHIFL: Inner membrane transport permease YhhJ (yhhJ) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1948)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ISA8 at UniProt or InterPro

Protein Sequence (375 amino acids)

>HSERO_RS09720 membrane protein (Herbaspirillum seropedicae SmR1)
MRQGLANLWQLTLKELWSLWRDRVMLCLIVLSFTGMVYSAASAIPDTLSHAAIAIVDEDD
SPLSQRLAAAFMAPQFSPPQRISVAEMDAGLDAGRYVFVLHFPAGLQSKLQTGKPAEVQL
NVDATRMDQAYSGSAYVEQILQLEIRRFLQKRQDEPREAATLALRARFNPALEKTWFSSV
LQIIDNITMLAIILAGAALIREREHGTIEHLLVMPVSPVQIMGAKVLAMGGVVLVAATLS
LHGVVRGLLDVPIEGSVGLFLFGAALSLFANTALGISLATVARSMPQFGLLLMLVLLPLI
LLSGGATPRESMPVLIQYLMLAAPSTHLVRLGEGVLYRGAGLEMVWPQLLALFLIGNILL
WVSLRRLRTMLTQMN