Protein Info for HSERO_RS09690 in Herbaspirillum seropedicae SmR1

Annotation: excinuclease ABC subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 621 TIGR00194: excinuclease ABC subunit C" amino acids 18 to 601 (584 residues), 574.6 bits, see alignment E=1.3e-176 PF01541: GIY-YIG" amino acids 28 to 100 (73 residues), 37.9 bits, see alignment E=4.5e-13 PF02151: UVR" amino acids 213 to 245 (33 residues), 32.6 bits, see alignment (E = 1.3e-11) PF08459: UvrC_RNaseH_dom" amino acids 409 to 554 (146 residues), 162.5 bits, see alignment E=1.9e-51 PF14520: HHH_5" amino acids 569 to 620 (52 residues), 33.3 bits, see alignment 1.4e-11

Best Hits

Swiss-Prot: 85% identical to UVRC_JANMA: UvrABC system protein C (uvrC) from Janthinobacterium sp. (strain Marseille)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 100% identity to hse:Hsero_1942)

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8ISA6 at UniProt or InterPro

Protein Sequence (621 amino acids)

>HSERO_RS09690 excinuclease ABC subunit C (Herbaspirillum seropedicae SmR1)
MSDLPASPLPDPREAVLETVARLPHLPGVYRYFDAEDNVLYVGKARDLKKRVSSYFQKTL
TSPRIAMMVERIARLETTVTRSEAEALLLENNLIKTLRPRFNILFRDDKSYPYLKITGHA
FPRMAYYRGAVDKRNQYFGPFPNAGAVKESIQILQKVFLLRTCEDTVFSNRTRPCLLHQI
HRCSGPCVNLVSREDYAIDVENASKFLRGRQSEVMEALEQKMHAFAADLKFEQAAAVRDQ
IGSLSSVLHQQSMETVSDADIDIIAVVVQGGRACVNLAMVRGGRHLGDRAYFPTHVDDAM
DTAEDSIDVEVLKAFLAQHYIDKFIPGSLIVGTEFDDPALMMALMEQCGHRITLTFQPQG
QRRQWLEMAAKGAEIALARLLSEQGSQQARTRALADVLELERDDLDELRAECFDISHTQG
EATQASCVVFHHHAMQNGEYRRYNINDITPGDDYAAMRQVLTRRYEKVANGEGVMPDIVL
IDGGKGQVETARQVLTELGLDISLIVGVAKGEGRKVGLETLVFADGRAPKELGKESAALM
LIAQIRDEAHRFAITGMRAKRAKARQSSRLEEIEGIGAKRRQRLLVRFGGLRGVADASVD
DLASVEGISRQLAEEIYRQLH