Protein Info for HSERO_RS09570 in Herbaspirillum seropedicae SmR1

Annotation: Fe-S oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 72 PF06945: DUF1289" amino acids 20 to 63 (44 residues), 64.8 bits, see alignment E=2.6e-22

Best Hits

KEGG orthology group: K06938, (no description) (inferred from 63% identity to bav:BAV0159)

Predicted SEED Role

"Phosphoenolpyruvate synthase (EC 2.7.9.2)" in subsystem Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.9.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.9.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (72 amino acids)

>HSERO_RS09570 Fe-S oxidoreductase (Herbaspirillum seropedicae SmR1)
MSSASVSPSSPQPLPERPDTPCVAVCSTTFDDVCRGCGRTVDEVAQWVFMDVEQRERVWQ
RILAQGYPRRNY