Protein Info for HSERO_RS09565 in Herbaspirillum seropedicae SmR1

Updated annotation (from data): nitrite efflux transporter, HPP family
Rationale: Specifically important in stress Sodium nitrite. Related to Synpcc7942_1745, which can be a nitrite uptake transporter (PMID:24904028), but this appears to be exporting nitrite. Besides the HPP domain, it encodes two cytoplasmic CBS domains, which might have a regulatory role.
Original annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 144 to 168 (25 residues), see Phobius details PF04982: HPP" amino acids 57 to 177 (121 residues), 145.4 bits, see alignment E=9.1e-47 PF00571: CBS" amino acids 246 to 298 (53 residues), 43.6 bits, see alignment 3.1e-15 amino acids 329 to 383 (55 residues), 48.2 bits, see alignment 1.1e-16

Best Hits

KEGG orthology group: K07168, CBS domain-containing membrane protein (inferred from 100% identity to hse:Hsero_1916)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IS80 at UniProt or InterPro

Protein Sequence (400 amino acids)

>HSERO_RS09565 nitrite efflux transporter, HPP family (Herbaspirillum seropedicae SmR1)
MDMPDSISLWFKSFIPAKANVDRFERMRSCAGSLFGILLVGMVSYAVLPHKAGTIWLIAP
MGASAVLLFAVPSSPLAQPWSIIGGNLCAALIGVTCAKLVPEPALAAALAIALAIGAMFY
LRCIHPPSGAVALTAVLGGPAVQAMGYGFVLSPVLLNSVLLLATALFFNNASGRRYPHAQ
QSAAPHPHHTRDELPITRLGFSHEDLDEVLKRYNQVLDIGRDDLEEIFLQTEMRAYHRRF
GQTLCASVMSRDVVAVEFATGLDEAWRLLQAHRLRALPVIDRGRHVIGIISRSDFLEHAG
VEVHTGLTAQLRALLHRVPLLHSDKPEVVGQIMSRPVVTAQVDTPLLELVPRMADGLHQI
PVVQADGKLAGMLTQSDMIAALYEKNLAAARSGPSLRSAA