Protein Info for HSERO_RS09475 in Herbaspirillum seropedicae SmR1

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 675 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01590: GAF" amino acids 76 to 206 (131 residues), 52.5 bits, see alignment E=2.8e-17 PF00158: Sigma54_activat" amino acids 361 to 530 (170 residues), 206.8 bits, see alignment E=6.3e-65 PF14532: Sigma54_activ_2" amino acids 362 to 535 (174 residues), 52.6 bits, see alignment E=2.1e-17 PF07728: AAA_5" amino acids 379 to 508 (130 residues), 26.5 bits, see alignment E=2e-09 PF01078: Mg_chelatase" amino acids 379 to 506 (128 residues), 22.3 bits, see alignment E=2.7e-08 PF02954: HTH_8" amino acids 639 to 671 (33 residues), 42.8 bits, see alignment (E = 1.2e-14)

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1898)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IS63 at UniProt or InterPro

Protein Sequence (675 amino acids)

>HSERO_RS09475 Fis family transcriptional regulator (Herbaspirillum seropedicae SmR1)
MQYQANRPSAGALLGTSPLVQASTDGVPDLQAIERSHQRSSSYGIMRGQRPDLDSLSRAD
LAQTLEANQTLSGHARPVMETLYDQIRNTHSMVILSDAEGTILHTLGDSDFLAKADRVAL
GPGGRWSEQLRGTNAIGTALFEQKPTTVHAQQHYLDANRFLTCSAAPIFDHRGQVLGVLD
VSGECGSFHKHTMALVRMSAQMIENHLLAGSFPDCITLHFHSRAEFVGTLVEGIVSFTPG
GRFLAANRSAQFQLGLTLAALQSHTFASLFGVPLSLLFEHHRKAAPGLLELCLHNGIRIH
GRAELRLRDQHFQAAREAVIDAPGLLPPAPNTTTPPPSPPQQRARHQRRPDLQALDTGDV
RMSAIIAKLRRVIDRDIPILITGETGTGKEWLAQAIHGDSARFGARQNRAGAAPFVAVNC
SAIPENLIEAELFGYEDGAFTGARRKGALGKIAQAHGGTLFLDEIGDMPLALQGRLLRVL
QERAVTPLGSQRVIPVDFALVCATNQPLREMAARHAFREDLYYRINGLQVKLPALRDRSD
LPQLIERILEDEGGPHAPRFDAQAQALLLASHWPGNLRQLANLVRTSLAMAEGEEAIGPH
HLPDDFLEEAGAPGALHDGMHTMHAVRSDCLSIQDNEWAAIERALRTHAGNVSAAAKALG
VSRNTIYRRLKSRGH