Protein Info for HSERO_RS09405 in Herbaspirillum seropedicae SmR1

Annotation: molybdenum cofactor biosynthesis protein MoeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 34 to 371 (338 residues), 389.9 bits, see alignment E=4.5e-121 PF04055: Radical_SAM" amino acids 47 to 217 (171 residues), 125.7 bits, see alignment E=3.2e-40 PF13353: Fer4_12" amino acids 52 to 161 (110 residues), 28.6 bits, see alignment E=2.5e-10 PF06463: Mob_synth_C" amino acids 224 to 350 (127 residues), 123.6 bits, see alignment E=7.4e-40

Best Hits

Swiss-Prot: 67% identical to MOAA_RALSO: GTP 3',8-cyclase (moaA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 100% identity to hse:Hsero_1884)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IRR9 at UniProt or InterPro

Protein Sequence (371 amino acids)

>HSERO_RS09405 molybdenum cofactor biosynthesis protein MoeA (Herbaspirillum seropedicae SmR1)
MNQRVIPIVDYRQAFPASEAGRLAPMAVQPTGWLSDSLGRPLHDLRISVTDRCNFRCVYC
MPKDVFDKQYQFLPHSDLLTFEELTRVAAQFVAHGVRKIRLTGGEPLLRKNIETLIGMLA
ALRTPEDEPVDLTLTTNGTLLKQKAQALKDAGLKRVTVSLDSLDDEGFRRMNDVDFPVAR
VLEGIDAAHAAGLGPVKINMVVKKGVNDDQILPMARYFKGTPAILRFIEYMDVGSSNGWR
MDEVLPSAEVVRLIATEMPLEVADPNYTGETAERWRYVDGSGEIGVISSVTQAFCQDCSR
ARLSTEGRVYTCLFASEGHDLRSIVRSGGSDAEIAGAIAALWGQRGDRYSELRSALREAP
LRKVEMSYIGG