Protein Info for HSERO_RS09360 in Herbaspirillum seropedicae SmR1

Annotation: lysine transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 41 to 65 (25 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 154 to 178 (25 residues), see Phobius details amino acids 199 to 215 (17 residues), see Phobius details PF01810: LysE" amino acids 15 to 211 (197 residues), 121.4 bits, see alignment E=1.7e-39

Best Hits

KEGG orthology group: K05834, homoserine/homoserine lactone efflux protein (inferred from 100% identity to hse:Hsero_1876)

Predicted SEED Role

"Homoserine/homoserine lactone efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IRR1 at UniProt or InterPro

Protein Sequence (219 amino acids)

>HSERO_RS09360 lysine transporter LysE (Herbaspirillum seropedicae SmR1)
MDYQTWFAFFAAACVIAISPGSGAVLSMSHGLNYGVRRTSATILGLEIALVVILIIAGAG
VGSLLVASETAFNVIKVAGALYLIYLGFSQWRARVPSEEQGEALDAANASARAHARQTWW
QRCMTGFLTNATNPKGIVFMVAVLPQFIDHDRPLWLQLLVLAVTMVAVDLVVMHGYAFAA
SRLQRFFRSQKAIRAQNRFFGGVLMLVGAGLFFFKRTQH