Protein Info for HSERO_RS09245 in Herbaspirillum seropedicae SmR1

Annotation: carboxylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF02230: Abhydrolase_2" amino acids 15 to 218 (204 residues), 171.9 bits, see alignment E=4.6e-54 PF03959: FSH1" amino acids 22 to 205 (184 residues), 21.8 bits, see alignment E=3.4e-08 PF01738: DLH" amino acids 93 to 204 (112 residues), 22.5 bits, see alignment E=1.9e-08

Best Hits

Swiss-Prot: 39% identical to APTH1_USTMA: Acyl-protein thioesterase 1 (UMAG_00130) from Ustilago maydis (strain 521 / FGSC 9021)

KEGG orthology group: K06999, (no description) (inferred from 100% identity to hse:Hsero_1853)

Predicted SEED Role

"probable carboxylesterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IRN9 at UniProt or InterPro

Protein Sequence (222 amino acids)

>HSERO_RS09245 carboxylesterase (Herbaspirillum seropedicae SmR1)
MAAPLDTIQIDTAPNPTASVIWLHGLGADGSDFVPIVRELDLSACPPIRFIFPTAPTMPV
TINGGYVMRAWYDIFAPDLVRREDEPGLRASQAAIEALIAQEKARGVPANRIVLAGFSQG
CAMTLQTGLRHPERLAGLMCLSGYLPLAATIEAERHAANHDTPIFMAHGTMDPVVVLERA
VKSRELLTQLGHPVEWHDYPMQHSVCGEEVEDIGAWLTRVLA