Protein Info for HSERO_RS09240 in Herbaspirillum seropedicae SmR1
Annotation: lipase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1852)MetaCyc: 39% identical to tert-butyl formate deformylase (Methylibium petroleiphilum PM1)
3.7.1.-
Predicted SEED Role
"Lipase"
MetaCyc Pathways
- methyl tert-butyl ether degradation (3/10 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See D8IRN8 at UniProt or InterPro
Protein Sequence (340 amino acids)
>HSERO_RS09240 lipase (Herbaspirillum seropedicae SmR1) MTSFKQLAAVAAIGLVFGNAYAAGDAGVEPTTQAFLQALEAGGGKPLEQLSPADARAVLV GAQASVKLQLPKADVSEKTISADGQQIKLTIVRPAGSAKKTLPAFMFFHGGGWVLGDFPT HERLVRDLVANSGAVAVFVNYTPSPEAHYGVAINQAYAATKWVAEHGKEINVDGKRLAVA GNSVGGNMAAVVALMAKDKGGPALRSEVLLWPVTDANFETASYNQFANGYFLTKNMMKWF WDSYTTDAAKRKEITASPLNATPAQLSGLPPTLIQTAEKDVLRDEGEEYGRKLAAAGVAV TSVRYNGMIHDFGLLNVLAKVPAVQTAMRQAGEELKFRLK