Protein Info for HSERO_RS09135 in Herbaspirillum seropedicae SmR1

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 923 transmembrane" amino acids 572 to 592 (21 residues), see Phobius details amino acids 728 to 751 (24 residues), see Phobius details amino acids 778 to 801 (24 residues), see Phobius details amino acids 807 to 829 (23 residues), see Phobius details amino acids 836 to 857 (22 residues), see Phobius details amino acids 899 to 918 (20 residues), see Phobius details PF00005: ABC_tran" amino acids 26 to 174 (149 residues), 96.1 bits, see alignment E=7.4e-31 amino acids 292 to 435 (144 residues), 101.2 bits, see alignment E=2e-32 PF12698: ABC2_membrane_3" amino acids 578 to 915 (338 residues), 143.8 bits, see alignment E=1.9e-45 PF12679: ABC2_membrane_2" amino acids 643 to 861 (219 residues), 43.9 bits, see alignment E=4.8e-15 PF01061: ABC2_membrane" amino acids 731 to 886 (156 residues), 50.5 bits, see alignment E=5e-17

Best Hits

KEGG orthology group: K13926, ribosome-dependent ATPase (inferred from 74% identity to azo:azo2910)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IRL7 at UniProt or InterPro

Protein Sequence (923 amino acids)

>HSERO_RS09135 ABC transporter (Herbaspirillum seropedicae SmR1)
MNTLPGGACVARLQRVALRYGKTVALDAVSLDIPAGCMVGLIGPDGVGKSSLLSLVAGAR
ALQQGELAVLGGDMRQQRHRQQACPRIAYMPQGLGKNLYPTLSVEENLQFFGRLFGQDAS
ERRRRIDELTTSTGLDKFLARPAGKLSGGMKQKLGLCCSLIHDPDLLILDEPTTGVDPLS
RAQFWDLIAHIRQQRAGMSVIVATAYMEEADRFDWLVAMDEGRVLATGTPVQLHQRTGTA
SLEEAFIALLPEEKRRGHQTVQVTPLDDTIDSGVAIEAKGLTMRFGDFLAVDHVDFRIRR
GEIFGFLGSNGCGKSTTMKMLTGLLPASEGQAWLFGREIDPRDMATRARVGYMSQAFSLY
GELSVRQNLVLHARLYRVPAEQIAARTDEMARRFGLLDVMDSLPESLPLGIRQRLSLAVA
MVHKPELLILDEPTSGVDPIARDLFWQLMIGLARQDQVTIFISTHFMNEALRCDRISLMH
AGRVLVSATPQALMQQRGAQTLEQAFIGYLEEAAGKGGSAAATHSAVAVAVAPPAASPAA
SPAPRLSRWRTSLGRALSYSQRESLELRRDPVRATLALLGTAILMFIIGYGINLDVENLS
YAVLDRDQTGLSQNYALNLSGSRYFIEKPPISDYQELDRRMRSGDISLAIEIPPGFARDI
ARGHTVEVGAWVDGAMPTRAETVRGYVQGMHQLWLADMATHRLGQSLAMPARIETRYRYN
PDVKSLPAMVPAIIPLLLMMIPAMLTALSVVREKELGSILNLYVTPVSRTEFLLGKQLPY
LLLGMLNFAMLTLLAVTVFGVPVKGSLLTLTLAALVFVICSTGFGLLASTFTNSQIAALF
VTMIGTIIPCVQFAGLLNPVSSLEGMGALIGQVYPATHFLTISRGVFSKALALDDLASSF
WPLVVAAPVILGLSVLLLKKQER