Protein Info for HSERO_RS09015 in Herbaspirillum seropedicae SmR1

Annotation: bacteriocin ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 282 to 308 (27 residues), see Phobius details PF00664: ABC_membrane" amino acids 37 to 295 (259 residues), 43.1 bits, see alignment E=6.8e-15 PF00005: ABC_tran" amino acids 362 to 509 (148 residues), 108.8 bits, see alignment E=5.3e-35 PF13304: AAA_21" amino acids 478 to 542 (65 residues), 30.7 bits, see alignment E=5e-11

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to hse:Hsero_1806)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IRJ2 at UniProt or InterPro

Protein Sequence (567 amino acids)

>HSERO_RS09015 bacteriocin ABC transporter permease (Herbaspirillum seropedicae SmR1)
MNASEQVHIDQPQVLQDLRADPSYLSLLRAYGSRFVEIIVAGIVVNVLGLLMPLYSRLIY
DKVIGNHIPETLWALTLGMLLFVALELVLRIIRVYYTEQLAGRLDSEFDEVSARRMLTAR
VQAPVGVVLARYRDLSAARDLMSSNYMLLLVDLPFLLLYLVVLGLIGGHMVWVLLVGGGL
LVGLQLLLKVPGNDYANSAMKAGTGKVDKLASIVYGMETLKTSPLQHRLLRAFLADASAN
AVAQAKSRFWMNTSYAISSVGYTLISVATLVVGVYLVEDNLLTVGALIACSLLISRAATV
LSSLAAFLGRIEMFRRARAEFDQLFEEPEQGPTADVLRQDMRGLIQVGNLLLHLDKKETP
TLRNISLTIQPGEKVGIVGRSGSGKSTLLRTLAGLHQAEEGHVLIDGVAVTAYAEEVRMR
CIGFKPQEPFLFDGTVAANIFVGDRVPGQVYEAALAVSSLDDLIARGELRLDQLIKAPGN
LSGGQRQMVALARVIACTPRILLLDEPTTGIDQQTEARIIERLVGYAGGRTLVVATHSPA
LLRHMDRIVVIDGGRIVADGPRAQILQ