Protein Info for HSERO_RS08555 in Herbaspirillum seropedicae SmR1

Annotation: agmatinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF00491: Arginase" amino acids 36 to 308 (273 residues), 324.8 bits, see alignment E=2.6e-101 TIGR01230: agmatinase" amino acids 39 to 308 (270 residues), 214.6 bits, see alignment E=1.1e-67

Best Hits

Swiss-Prot: 72% identical to GBUA_PSEAE: Guanidinobutyrase (gbuA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01480, agmatinase [EC: 3.5.3.11] (inferred from 100% identity to hse:Hsero_1718)

MetaCyc: 72% identical to guanidinobutyrase subunit (Pseudomonas putida)
Guanidinobutyrase. [EC: 3.5.3.7]

Predicted SEED Role

"Agmatinase (EC 3.5.3.11)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.11 or 3.5.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IQX0 at UniProt or InterPro

Protein Sequence (317 amino acids)

>HSERO_RS08555 agmatinase (Herbaspirillum seropedicae SmR1)
MEHALYQPLGGNVMPRFGGIATMMRLPHVEDPAGLDVGFVGVPLDIGTSNRSGTRFGPRQ
IRTESVLLRPYNMATRAAPFDSLKVADLGDVALNPYSLLDSVRMIEEAYDRIYATGCKTI
SLGGDHTLTLPILRALARYRGPVGLIHVDAHADVNDTMNGEKIAHGTPFRRAFEEGLLDP
QRVVQIGLRGTGYHADDFDWCRAQGFRVVQAEECWHRSLAPLMEEVRAQMGDGPVYLTFD
IDGLDPAFAPGTGTPEIGGLTVQQGLEIIRGCKGLDIVSADVVEVSPPYDQAGTTALVAA
NLAYEMLCILPGVTYRT