Protein Info for HSERO_RS08100 in Herbaspirillum seropedicae SmR1

Annotation: nicotinate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 TIGR01514: nicotinate phosphoribosyltransferase" amino acids 2 to 389 (388 residues), 482 bits, see alignment E=7.7e-149 PF17767: NAPRTase_N" amino acids 7 to 128 (122 residues), 135.7 bits, see alignment E=1.1e-43 PF04095: NAPRTase" amino acids 164 to 389 (226 residues), 269.5 bits, see alignment E=2.9e-84

Best Hits

Swiss-Prot: 76% identical to PNCB_BURPS: Nicotinate phosphoribosyltransferase (pncB) from Burkholderia pseudomallei (strain K96243)

KEGG orthology group: K00763, nicotinate phosphoribosyltransferase [EC: 2.4.2.11] (inferred from 100% identity to hse:Hsero_1629)

Predicted SEED Role

"Nicotinate phosphoribosyltransferase (EC 2.4.2.11)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 2.4.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.11

Use Curated BLAST to search for 2.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IQN1 at UniProt or InterPro

Protein Sequence (391 amino acids)

>HSERO_RS08100 nicotinate phosphoribosyltransferase (Herbaspirillum seropedicae SmR1)
MIITSLLDTDLYKFTMMQVVLHHFPGAQVEYRFKCRNENVDLRPYVDEIRAEIAALCRLR
FKEDELNYLRSLRFIKSDFVDFLDLFHLNEKYITVQPDPAGNGEIEISVKGPWLHTIMFE
VPVLAIVNEVYFRATQRSPDLEEGRARLRKKMSVITDDPELAGCKIADYGTRRRFSRSWH
AEVIDEMKQHMGDHFAGTSNVMYAMQHDLTPLGTMAHEYLQACQALGPRLRDSQTFAFEM
WAREYRGDLGITLSDVYGMDAFLRDYDMYFCKLFDGARHDSGDPFEWGERLIQHYRDNRV
DPSSKVLVFSDSLDFDKVRALYLRFKDRAKVAFGVGTNLTNDLGYTPLQVVMKMVRCNGQ
PVAKLSDTPSKNMCDDPAYVNYLRQVFQIKA