Protein Info for HSERO_RS08065 in Herbaspirillum seropedicae SmR1

Annotation: branched-chain amino acid ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 40 to 379 (340 residues), 196.5 bits, see alignment E=1.6e-61 PF13433: Peripla_BP_5" amino acids 48 to 238 (191 residues), 28.7 bits, see alignment E=1.1e-10 PF01094: ANF_receptor" amino acids 60 to 379 (320 residues), 73.7 bits, see alignment E=2.2e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1619)

Predicted SEED Role

"Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IQM1 at UniProt or InterPro

Protein Sequence (394 amino acids)

>HSERO_RS08065 branched-chain amino acid ABC transporter substrate-binding protein (Herbaspirillum seropedicae SmR1)
MQCVARLLAALLALATLGAPVGATAQPRAPLPDRQETATLAIGFAGPLSGPSGGVGKSMQ
NGVQLALAEANRRGLRIGGKSWQLRLIAQDDRADPATAEFVARSLVQQQVIAVVGHWTSG
TSLAAAPVYHRAGVIQVTPSAMSRRLTAMSYPRIFRTIPNNESLGRLAAGYAVDKLETRT
IVTIDDRTPFGQGLAEQFARTASERGAQVVGRYSVSDKTSDFNAALLEARKLQPDLIFFG
GLDWQAGVLAKSIRRLKLHARLMASPGTLGLPFLMRAGPDANGALVLEPGPPQDKMPGWK
SFRQRYSENFDSDMDLYAVFAYEAAQAIIQGIRQAGSADPERIAEAMHRLRFEGVSGPVA
FNEEGDLLQPSFTMYEVKDQRWQPVARFNGLPRQ