Protein Info for HSERO_RS07700 in Herbaspirillum seropedicae SmR1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 85 to 111 (27 residues), see Phobius details amino acids 118 to 141 (24 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 101 to 266 (166 residues), 64.6 bits, see alignment E=5.2e-22

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to hse:Hsero_1531)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IQ00 at UniProt or InterPro

Protein Sequence (278 amino acids)

>HSERO_RS07700 ABC transporter permease (Herbaspirillum seropedicae SmR1)
MSTLSSSLPLLEQAGPRRWSAGQWSGLVLLLLVAGFALLGPLVIDTDPARQQLARYLETP
SLAEPLGFDQLGRSMLARLAHGARLSLSLALLSVLSAAIPGSLIGLLAAWCGGWTERVLA
ALADAVLALPGLLLVLLLAAFAPGGFWPLYVGISLALWVEYFRVVRAASRILLASPQVEA
SRLLGFGALYIVRCHLLPALLPRLLTLVRFGLAGAVLAMSALGFVGVGLQPPTPELGVMM
IELLPYYREAPWLVASPVLVLFLGLLGLLLLSSQGEAA