Protein Info for HSERO_RS07595 in Herbaspirillum seropedicae SmR1

Annotation: DNA mismatch repair protein MutT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 204 to 221 (18 residues), see Phobius details PF00293: NUDIX" amino acids 62 to 143 (82 residues), 48.7 bits, see alignment E=4e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1510)

Predicted SEED Role

"Hypothetical nudix hydrolase YeaB" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IPX9 at UniProt or InterPro

Protein Sequence (223 amino acids)

>HSERO_RS07595 DNA mismatch repair protein MutT (Herbaspirillum seropedicae SmR1)
VASFDPVNLPVDAVAGEGALEAARLNADWLRQRFADPPRWEPEHSGDQMARLAESKGRFR
LASVLIPIVLREQGMTILFTRRTADLKDHAGQISFPGGRREDYDGSAIETALRETEEEIG
LARQHIEVIGSLPDYFTGTGYRVTPVAGLIQPPFEAVGDPREVAEIFEVPLAFLMDGVNH
QRRSVELPAPVGRRSFYTMPYDRYFIWGATAGMLRNLFHFLRS