Protein Info for HSERO_RS07225 in Herbaspirillum seropedicae SmR1

Annotation: DNA-3-methyladenine glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 PF03352: Adenine_glyco" amino acids 10 to 187 (178 residues), 261 bits, see alignment E=2.7e-82

Best Hits

Swiss-Prot: 51% identical to 3MG1_ECOLI: DNA-3-methyladenine glycosylase 1 (tag) from Escherichia coli (strain K12)

KEGG orthology group: K01246, DNA-3-methyladenine glycosylase I [EC: 3.2.2.20] (inferred from 100% identity to hse:Hsero_1437)

MetaCyc: 51% identical to 3-methyl-adenine DNA glycosylase I, constitutive (Escherichia coli K-12 substr. MG1655)
DNA-3-methyladenine glycosylase I. [EC: 3.2.2.20]

Predicted SEED Role

"DNA-3-methyladenine glycosylase (EC 3.2.2.20)" in subsystem DNA Repair Base Excision (EC 3.2.2.20)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IPD3 at UniProt or InterPro

Protein Sequence (189 amino acids)

>HSERO_RS07225 DNA-3-methyladenine glycosylase (Herbaspirillum seropedicae SmR1)
MTQTLTRCGWVNLANPRYIDYHDHEWGVPCHDETRLFEMLNLEGAQAGLSWETVLNKRES
YRAAFDGWDAEKIARYDERKVAQLLADPGIVRNRLKVAATIGNARAYLKLREEIGGLDAY
LWAHVDGQAIVNRWASLAECPAKTPLSDAISKDLARRGFKFVGSTIIYAYLQGVGVINDH
VQDCHCHGR