Protein Info for HSERO_RS06550 in Herbaspirillum seropedicae SmR1

Annotation: benzoate 1,2-dioxygenase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF00355: Rieske" amino acids 54 to 138 (85 residues), 73.5 bits, see alignment E=1.1e-24 PF00848: Ring_hydroxyl_A" amino acids 205 to 390 (186 residues), 57.7 bits, see alignment E=1.6e-19

Best Hits

Swiss-Prot: 64% identical to CBDA_BURCE: 2-halobenzoate 1,2-dioxygenase large subunit (cbdA) from Burkholderia cepacia

KEGG orthology group: K05549, benzoate 1,2-dioxygenase alpha subunit [EC: 1.14.12.10] (inferred from 100% identity to hse:Hsero_1308)

MetaCyc: 64% identical to 2-halobenzoate 1,2-dioxygenase large subunit (Burkholderia cepacia 2CBS)

Predicted SEED Role

"Benzoate 1,2-dioxygenase alpha subunit (EC 1.14.12.10)" in subsystem Benzoate degradation (EC 1.14.12.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10

Use Curated BLAST to search for 1.14.12.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IP04 at UniProt or InterPro

Protein Sequence (462 amino acids)

>HSERO_RS06550 benzoate 1,2-dioxygenase subunit alpha (Herbaspirillum seropedicae SmR1)
MNTTAAADRYDELDTLLQSALQEDKDNGVFRCRRDIFTNPDLFELEMKHLFESNWVYLAH
ESQIPEINDYYTTWIGRQPVVITRDKSGQLNAVINACSHKGAMLCRRKHGNKSSFTCPFH
GWTFSNSGKLLKVKDEKTTEYPVSFNKNGSHDLTRVARFQSYRGFLFGSLSEDVLPLEEY
LGETRVIIDQIVDQAPNGLEVLRGNSSYLYDGNWKMQMENGCDGYHVSSVHWNYAATMSR
RKEGGTKATDANNWSKAVAGVYGFENGHILLWTNTLNPEVRPIWNQREELAARVGQARAD
TIVAQTRNLCLYPNVFLMDQFGTQIRVARPISVDKTEISIFCFAPKGESEEDRRVRIRQY
EDFFNVSGMGTADDLEEFRACQAGYAGSAVRWNDMSRGAPLWKEGPDENARKMGMHPKLS
GERSEDEGLFVCQHHYWTEQMRKAVKKERAAAQQGSQQGAQA