Protein Info for HSERO_RS06500 in Herbaspirillum seropedicae SmR1

Annotation: ATP-dependent DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 758 PF00270: DEAD" amino acids 202 to 271 (70 residues), 24.9 bits, see alignment E=3.2e-09 PF06733: DEAD_2" amino acids 284 to 406 (123 residues), 40.3 bits, see alignment E=5.6e-14 PF13307: Helicase_C_2" amino acids 598 to 758 (161 residues), 127 bits, see alignment E=1.7e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1297)

Predicted SEED Role

"DinG family ATP-dependent helicase CPE1197" in subsystem DNA repair, bacterial DinG and relatives

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8INZ3 at UniProt or InterPro

Protein Sequence (758 amino acids)

>HSERO_RS06500 ATP-dependent DNA helicase (Herbaspirillum seropedicae SmR1)
MAAAGRMSSAPLAPARRYTVSVRALCEFTAKAGDLDLRFTPTPTARQGMEGHAIVASRRG
EHYQSELALAIDHGALHVRGRADGYDADRQLLEEVKTYRGQLASIPDNHRHLHWAQLRVY
GHLLCQAQGLERVNLALVYFEIGSQQETRLEESRSREELAELFGALCERFIGWAAQELAH
RQARDAALEQLRFPHGDFRPGQRQLAEAVFRAHAGRRSLLAQAPTGIGKTLGTLFPALKA
APRQQLDKVLFLAAKTPGRQLALDAAATLKGQGVLPLRVLELSAREKACEHPERLCRGDS
CPLAQGFYDRLAQARAACLDAPLLDRASLRQIALAHQVCPYYLGSEMTRWSDVIVGDYNY
WFDGGAMLYAMAQAHDWRVSVLADEAHNLVARARGMYSAQLSRASLRAARAVAPAAVAKL
LEKIGRAWSAIGKQALLPYQVLEAMPPRFIETLSAANNAISDHLAQVAVPLEPPLRDFHL
EAMAFVRLAESFGPHSLLDLTRQDERNTVLAVRNVVPAPFLGPRFAQAHATTLFSATLGP
WHYFADLLGMPKDTAWIDVESPFHASQLEVRVAQDISTRWQRRSASIAPITALMARQFHQ
RPGNYLAFFSSFDYLQQALAAFTRAHPDIPTWQQSRGMSEAEREAFLARFVVGGRGIGFA
VLGGSFGEGVDLPGERLIGAFVATLGLPQVNEVNEQLRLRMQALFGAGYDYTYLYPGLQK
VVQAAGRVIRTESDQGVVWLIDERFAQPEVQALLPSWW