Protein Info for HSERO_RS06495 in Herbaspirillum seropedicae SmR1

Annotation: nuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 380 to 402 (23 residues), see Phobius details amino acids 455 to 476 (22 residues), see Phobius details PF21315: FAN1_HTH" amino acids 7 to 86 (80 residues), 109 bits, see alignment E=1.3e-35 PF18081: FANC_SAP" amino acids 91 to 143 (53 residues), 55.5 bits, see alignment 8.2e-19 PF08774: VRR_NUC" amino acids 434 to 544 (111 residues), 126.2 bits, see alignment E=1e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1296)

Predicted SEED Role

"Hypothetical protein, restriction endonuclease-like VRR-NUC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8INZ2 at UniProt or InterPro

Protein Sequence (551 amino acids)

>HSERO_RS06495 nuclease (Herbaspirillum seropedicae SmR1)
VPSARPFYYLDNFQQVLDWLAQRCADLLDLRERQFIVAFPGLPLPSRALFVRMMMRKGEL
FRSGRLDYPEIGCPLEAAKGLPEDWVERDAALTLEQFFSLSTKPELVRAFALTGAQRAAR
KTDLLAQLAADPAWDQARVLRQWCRQGDELALRLRVQDLCDRLRLMFFGNLRQDWSEFVL
ADLGRFRYERVALSPEARGFRQRSDVDHYLRLHACSEALEAGEDAADVMAALTVAAPAEG
HDNPWLQSRYERLLFKLGQHLEKQGHWPQAHAVYARCPYPGARGRAMRVLEKQGRYAQAY
ALFQAAQAAPESEAERQHLQRIGPRLTRQLGYPPMVRVRTLPPQRLDLVLAMQAGQGVEA
AVRAHLQAPDAPVFYVENTLATALFGLLCWDAIFAAIPGAFFHPFQREPADLHSADFHAR
RREAFAHCLARLDQERHREAILAAYEDKQGVLSPFVSWGAISRGLLVLALDCIPAWHLKH
WCLRILEDVRENRSGFPDLIQFWPQQRRYRMIEVKGPGDRLQDNQQRWLAFCAQHQMPVA
VCYLQWQQQVA