Protein Info for HSERO_RS06410 in Herbaspirillum seropedicae SmR1

Annotation: iron transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 703 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF07715: Plug" amino acids 65 to 179 (115 residues), 74.6 bits, see alignment E=1.3e-24 TIGR01783: TonB-dependent siderophore receptor" amino acids 68 to 703 (636 residues), 280.1 bits, see alignment E=2.2e-87 PF00593: TonB_dep_Rec" amino acids 260 to 671 (412 residues), 177.5 bits, see alignment E=1.4e-55 PF14905: OMP_b-brl_3" amino acids 308 to 683 (376 residues), 52.9 bits, see alignment E=4.9e-18

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to hse:Hsero_1277)

Predicted SEED Role

"Iron(III) dicitrate transport protein FecA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8INX3 at UniProt or InterPro

Protein Sequence (703 amino acids)

>HSERO_RS06410 iron transporter (Herbaspirillum seropedicae SmR1)
MKTHQAPSLFVRDLRITTTALASLAILAFPVAGLAQQASPSDGQPGLEPIQVSGDWLGTG
LESSVKTYPGARTVVKKQEIESTGAVSIGDAMRRIPGVQSSDNSGTAGSAIALNIGVRGL
AGRYSPRSTILLDGIPMAVAPYGQPQLSFAPLSLNNIESIDVVRGGGAVRFGPQNVGGII
NFKTRSIPTTPGISGDAAVRYNSYGQGGGNTQYTAFAGGQAENGFGMAFLYSGQEGSGWR
DKSDEHLNDFALKMRYEISPTSELYAKINYYDVLSRTPGGLSVAQYAADPFQSTRQRDNW
GGTRKGFDVGYLNTISDRQEFEIRTYFSQATRQSTLINPAGTRLSHQPRNYETLGIEPRY
TQRFAWGGTTHDVTVGYRYVRERGDDNVYSEAVLTGVLSGFTQFQNSTDAHAGYIDDKIA
FGKWRITPGLRFEHVQSTRYDVANNASYQVSNNKPLPSINVAYLLTEQLTLFSNYNTSFG
VVQNSQLNTMSSANPLSPELAKTIEGGVRWKSARASAEATVFHIDFDNQIVSVQGTNPSV
FRNIGKTQHDGIELAMDYAFDQQSVLKGWSVYANYTYTRALQKSGANPGKDLPFYARTTD
TVGTRFKSGPWGFNLSTTHQGRQFSDEANTIAESADGSIGEIPGFRLWNAQVDWKVPGTK
GFDVFAGINNLTDRRYFTRTTDNNLGKLVGAPRTVYVQGRYSF