Protein Info for HSERO_RS06100 in Herbaspirillum seropedicae SmR1

Annotation: Tol-Pal cell envelope complex subunit YbgF protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF16331: TolA_bind_tri" amino acids 45 to 116 (72 residues), 58.8 bits, see alignment E=1.8e-19 PF13525: YfiO" amino acids 129 to 251 (123 residues), 50 bits, see alignment E=1.4e-16 TIGR02795: tol-pal system protein YbgF" amino acids 130 to 247 (118 residues), 129.7 bits, see alignment E=4.1e-42 PF13174: TPR_6" amino acids 134 to 163 (30 residues), 24.3 bits, see alignment 1.4e-08 amino acids 169 to 199 (31 residues), 22.5 bits, see alignment 5e-08 amino acids 205 to 237 (33 residues), 36.1 bits, see alignment 2.3e-12 PF13432: TPR_16" amino acids 134 to 201 (68 residues), 47.3 bits, see alignment E=9.2e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1216)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8INR2 at UniProt or InterPro

Protein Sequence (251 amino acids)

>HSERO_RS06100 Tol-Pal cell envelope complex subunit YbgF protein (Herbaspirillum seropedicae SmR1)
MHTAFKLKSVTVAALLAATAFLPLTARAGLFDDDEARKAILDIRSKIEALQRDVANKADK
NSVLTLSDRNDNLQSQIAALRGQIEVLTNEITNAQQRQKDFYVDLDARLRKLEPQQVQVD
GQTVAVGVSEQQAYDAALSQFKGGDYKGAANAFADFLKRYPQSGYAPSAQYWQGNSLYAQ
RDYKGAIAAQQVVVKNYPDNPKAADALLNIASSQAELKDKAAAKKTLEQLIAKYPNTPAA
QTGKERMASLK