Protein Info for HSERO_RS06025 in Herbaspirillum seropedicae SmR1

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 677 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 105 to 130 (26 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 316 to 440 (125 residues), 40.4 bits, see alignment E=1.5e-14 PF00989: PAS" amino acids 321 to 430 (110 residues), 24.8 bits, see alignment E=3.9e-09 PF08448: PAS_4" amino acids 326 to 435 (110 residues), 65.5 bits, see alignment E=1e-21 PF07730: HisKA_3" amino acids 472 to 538 (67 residues), 41.5 bits, see alignment E=3.1e-14 PF02518: HATPase_c" amino acids 578 to 669 (92 residues), 57.8 bits, see alignment E=2.8e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1201)

Predicted SEED Role

"Probable two-component sensor, near polyamine transporter" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1U7 at UniProt or InterPro

Protein Sequence (677 amino acids)

>HSERO_RS06025 histidine kinase (Herbaspirillum seropedicae SmR1)
MQKNNDGLRPSSADIQNSASVEYFAASHAHYSSMATLAMGLAMAVILLGLVVLLASLLGE
EYRRLLSGLLEMREMTAVGLILGASALYLRCIHGGARRSGLRRVAAGLSWMLLALGLGTL
AHGLMYALGWLPIDQNHPLSPLVIPPLLSLGFVVMAAVLLLQDWRMLGGYYPAEYLSFAL
IGLAAIPLVGYLYGVSQFVYLDFPLPVSLLSALVMALLATALLMARPAHPLMAIITRIAP
GGQMLRHLLPQTVFLLLAFSLLLNWGMTHGWILPELLLPTLTLINGVIVLFIFWGSASRL
DSEYGERTRNAQKLAETSALLNAVSESTSDPIFVKNRQGLMIFANPATLHKLGKTWEETM
YRSSRELFLVPEEADTIDRDDRRVMASGKPEKLEQTLHLPEGVVTFQTAKVPWFGKDGSV
QGVIGISTDITERKQAEDELRQRESQLEKTVIQRTALLRELTNHLETVREEEKRAIAREL
HDNMGASLTALSMHLEGVYQILPPDEKWADRKVRMQGLMKSLVATTRRIQTELRPNTLDL
FGLKAAISEQLDELHERTGIACHASLPDEDVEVGHEMEIAIYRMLQEMLNNVTKHAKASK
VDVILDIDEDHVALTVRDDGVGIPEERRDNHKTYGLRGLRERATFFGGEVDIRSTPGKGA
LITISLPIRPELVPSEA