Protein Info for HSERO_RS05850 in Herbaspirillum seropedicae SmR1

Annotation: exodeoxyribonuclease VII large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 PF13742: tRNA_anti_2" amino acids 29 to 122 (94 residues), 106.1 bits, see alignment E=1.4e-34 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 30 to 372 (343 residues), 433.5 bits, see alignment E=4.2e-134 PF01336: tRNA_anti-codon" amino acids 50 to 122 (73 residues), 45.7 bits, see alignment E=7.8e-16 PF02601: Exonuc_VII_L" amino acids 145 to 455 (311 residues), 362 bits, see alignment E=5.2e-112

Best Hits

Swiss-Prot: 68% identical to EX7L_JANMA: Exodeoxyribonuclease 7 large subunit (xseA) from Janthinobacterium sp. (strain Marseille)

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 100% identity to hse:Hsero_1166)

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1R2 at UniProt or InterPro

Protein Sequence (465 amino acids)

>HSERO_RS05850 exodeoxyribonuclease VII large subunit (Herbaspirillum seropedicae SmR1)
MPSDKFPPFPTARPLAPAAPSADGGPPMLTVSALNQAVGRMLERNFPLLWVKGEVSNFTR
AASGHWYFNLKDEGAQVRAVMFKGRAQYAGFMPREGDKVEVRTLVTLYAPRGDYQLNVEA
IRRSGVGDLYAAFLQLKERLEREGLFARERKRALPGFPRRIGIVTSPQAAALRDVLTTLR
RRAPHVEVVLYPTPVQGEGAGQRIAAAIGRASERAECDVLLVCRGGGSIEDLWSFNEEVV
ARAIVAATMPVISGVGHETDFTIADFAADLRAPTPTAAAELAASSRQDWLAELRGHAADL
TRALRRTLADKAQSVDWLSRRLVSPSAYIQHERVKLLALQNRLSHANQIPLTRMRHGLQQ
LASRLAHQLPDTRHARRDLAELARRLQRAQGAQQSAQRQTLTTLHSQLELLNPQRTLERG
YAIVSDHQGRVLHSPAELAARSEITIRLAQGSAEVGIASVQPRLD