Protein Info for HSERO_RS05825 in Herbaspirillum seropedicae SmR1

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00497: SBP_bac_3" amino acids 26 to 245 (220 residues), 180.5 bits, see alignment E=1.7e-57

Best Hits

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 100% identity to hse:Hsero_1161)

Predicted SEED Role

"ABC transporter amino acid-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1Q7 at UniProt or InterPro

Protein Sequence (248 amino acids)

>HSERO_RS05825 ABC transporter substrate-binding protein (Herbaspirillum seropedicae SmR1)
LVGSVALAAAVATLGSAPAMAQASYNVGATSTGVPFTFLDIKTNKLQGMMVDTVTAVGNK
AGFSVNIQQTPFAALIPSLTGNKIDIIAAAMLKTEARAQIVDFSDPVYSYGEGLFVNAQD
GKSYKNLDDLKGEIVGAQVGTVFVDALNKKGGFKEVKTYDSVADMMRDVALGRIKAGFGD
RPIVAYQLAQGANPQVRLVKEYQPTLMGDVCLVIRKGDPKLMERLNKAIAELKADGTLAR
IVEQWKLN