Protein Info for HSERO_RS05735 in Herbaspirillum seropedicae SmR1

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 298 to 316 (19 residues), see Phobius details amino acids 323 to 340 (18 residues), see Phobius details amino acids 346 to 366 (21 residues), see Phobius details amino acids 377 to 401 (25 residues), see Phobius details amino acids 411 to 432 (22 residues), see Phobius details PF07690: MFS_1" amino acids 35 to 397 (363 residues), 162.4 bits, see alignment E=7.5e-52

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1143)

Predicted SEED Role

"D-galactarate permease" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1N9 at UniProt or InterPro

Protein Sequence (442 amino acids)

>HSERO_RS05735 MFS transporter (Herbaspirillum seropedicae SmR1)
VETPQPAASATGAAAPTVLQQAVAKIKQRVLPLFVIMFIVNYIDRVNIGFVRSHLATDVG
IGTAAYGLGAGLFFVGYALFEVPSNLLLQRFGAKAWLTRIMATWGLAATAMAFVNSETTF
YVLRFLLGAAEAGFFPGVIYYFTQWLPASERGRAMAIFLSGSALASILSGPISGGLLQID
GGGLQGWQWMFIIEGMASVLLCGFVWFWLDSMPADAKWLTAQERSAITRAIVDEQAERMK
HQPAQVSPRQLLRDPQILIFCFIYFSISLTIYGATFWLPSIIRKMGSFSDFQVGLFNSIP
WLISIVAMYAFAALAARFKHQQAWAATALVIAAAGMFASTFGNSVYAFVSICFAAVGFKA
ASSLFWPLPQAYLDARIAAGVIALINSIGNLGGFVAPTAFGFLEQRTGSIQGGLMGLAIT
SLVAAGVVFLARSGPGATRRPR