Protein Info for HSERO_RS05675 in Herbaspirillum seropedicae SmR1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 103 to 125 (23 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 241 to 265 (25 residues), see Phobius details amino acids 285 to 310 (26 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 6 to 89 (84 residues), 51.6 bits, see alignment E=1e-17 PF00528: BPD_transp_1" amino acids 118 to 316 (199 residues), 111.7 bits, see alignment E=3.7e-36

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to hse:Hsero_1131)

Predicted SEED Role

"Peptide ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1M7 at UniProt or InterPro

Protein Sequence (318 amino acids)

>HSERO_RS05675 ABC transporter permease (Herbaspirillum seropedicae SmR1)
MNGMVLRLIARRLLQAVLTLLLVSAGVFFITNLLPGDAAQTALGQAATPETVAALRLQYG
LDLPAPLRYAHWLGNLLSGNPGMSLVNNVPVAQMIGGRLPASLMLAAVTALVSVPLALFL
GIFSAMYRGSFFDRAVNVSAVSMVSVPEFLVATVAVMIFAVKLRWLSALSHAGDAATLGA
FIKAYAMPVLTLCCVIVAQMTRMTRAAVIDQLRSSYAEMALLKGVKRTRIVLRHALPNAI
GPIANAVALSLSYLLGGVIIVESIFNYPGIATLMIDAVTTRDMPLVQACSMIFCAGYLLL
VLTADVLAIVSNPRLKTR