Protein Info for HSERO_RS05475 in Herbaspirillum seropedicae SmR1

Annotation: gluconokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 transmembrane" amino acids 450 to 469 (20 residues), see Phobius details TIGR01314: gluconate kinase" amino acids 9 to 513 (505 residues), 726 bits, see alignment E=1e-222 PF00370: FGGY_N" amino acids 9 to 253 (245 residues), 223.4 bits, see alignment E=3.4e-70 PF02782: FGGY_C" amino acids 263 to 457 (195 residues), 136.7 bits, see alignment E=9.1e-44

Best Hits

Swiss-Prot: 54% identical to GNTK_BACSU: Gluconokinase (gntK) from Bacillus subtilis (strain 168)

KEGG orthology group: K00851, gluconokinase [EC: 2.7.1.12] (inferred from 100% identity to hse:Hsero_1092)

Predicted SEED Role

"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1I8 at UniProt or InterPro

Protein Sequence (520 amino acids)

>HSERO_RS05475 gluconokinase (Herbaspirillum seropedicae SmR1)
MSTSALARYMLGVDIGTTSTKSVVFTLDGKVVAQHAEEYPVLCTEPGMAEQDPEQIVAAA
LASIAGAVKAAKAAPQEIALLSFSAAMHSVIALDAENRLLSNSITWGDIRASVWAERIKH
EHDGNAIYRRTGTPVHPMSPLCKLMWMRHEKPDVFHRAARFVGIKEYLLYQLFGQWVVDH
SIASATGMFNLRELAWDQGALALLGVRPDQLPTPVPTTHRLPALSSEMAQRLGLSVDTPF
IIGANDGVLSNLGVNAIEIGHVAVTIGTSGAMRTVIDEPRTDPQGRLFCYALTEKHWVVG
GPVNNGGNIFRWVRDELATAEAAAAREEGVDPYEALTRIAEKVRPGAEGLLFHPFMAGER
APLWNADLRGSFFGLALHHGKHHMIRAALEGVIFNLYSILPALEELVGPTKRMMATGGFA
RSALWRQMMADIFNREVVVPESVESSCLGAAVLGAWALGLVPSLSVISGMVGSTNHHAPE
AEAVAVYGRLQPIFAAIPAKLEAEYHAIAAFQREAGRPHP