Protein Info for HSERO_RS05460 in Herbaspirillum seropedicae SmR1

Annotation: LacI family transcription regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 PF00356: LacI" amino acids 27 to 72 (46 residues), 55.9 bits, see alignment 6e-19 PF00532: Peripla_BP_1" amino acids 84 to 333 (250 residues), 85.8 bits, see alignment E=7.3e-28 PF13407: Peripla_BP_4" amino acids 86 to 334 (249 residues), 59.9 bits, see alignment E=6.2e-20 PF13377: Peripla_BP_3" amino acids 192 to 352 (161 residues), 110.8 bits, see alignment E=1.5e-35

Best Hits

KEGG orthology group: K06145, LacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor (inferred from 100% identity to hse:Hsero_1090)

Predicted SEED Role

"Gluconate utilization system Gnt-I transcriptional repressor" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1I6 at UniProt or InterPro

Protein Sequence (352 amino acids)

>HSERO_RS05460 LacI family transcription regulator (Herbaspirillum seropedicae SmR1)
MTQRAASKSKPKSPPAVRGSRATGRVTIIDVAAEAGVSPMTVSRALKTPALVQEQSRQRI
LEAIDKLGYVPNQAAATLASARSQVVAVLVPSLTNAVFIETLSGIRDYLASVGYQFLIGE
TGYDRHKEEELIATYLAHAPAGFLLSSSQQHDILQSRPASRAIPAVRMFDLGRSQQDYSV
GFSQTRAGHAVARHLAERGYRRPAFLAAQLDPRMMKRREGFRKGLQEAGLAADIEVLLPQ
PTTVDMGAQLLRRVLQDHPDCDSVFCCNDDLALGALFECQRQGISVPRQMAIAGFNDLSW
AACATPSITTVVTPRYDIGYQSAEMLVRQLKGEEIAKGRLDLGFELAVREST