Protein Info for HSERO_RS05435 in Herbaspirillum seropedicae SmR1

Annotation: hemolysin protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details PF01595: CNNM" amino acids 9 to 197 (189 residues), 169.3 bits, see alignment E=1e-53 PF00571: CBS" amino acids 221 to 277 (57 residues), 26.8 bits, see alignment 8.1e-10 PF03471: CorC_HlyC" amino acids 357 to 433 (77 residues), 57.7 bits, see alignment E=1.4e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1085)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J1I1 at UniProt or InterPro

Protein Sequence (440 amino acids)

>HSERO_RS05435 hemolysin protein (Herbaspirillum seropedicae SmR1)
LENILLIVVAFFLVALNGFFVAAEFSLVKLRQTRIRAIAKTQGMRGRILAVVHNQLDAYL
SACQLGITLASLGLGWIGEPAFARILEPLFSLAGVTNQELIHGVSFVFAFFVISFLHIVA
GELAPKSMAIRSPEKLGLWCAMPLYGFYWGMYPLIWVLNASSNWLLRVAGLGAGHGHDAH
YSSDELKLILRAGNKSGKNGKFTRDEWNVLTQSLNFAELDVADIMRPASEIVALGDDKSL
EENLDIIYRNRYSRYPYYDAERQQVLGLVHLKDVFLAQQDGRAIANLKDYLRPVQYISPA
LPALDLLRRFRTGSPHFAVIGKKGQPPAGFITLDNMLSLLVGEIRDEFRHNTGEWTRQDD
GTLLGKGSLPIVTLENMLGIDIEYDDSIDSVGGLVMEKLGDLPKEGQKIDFPAFDVVIKR
MSGPKIVLVKVYPKLQEARE