Protein Info for HSERO_RS05430 in Herbaspirillum seropedicae SmR1

Annotation: NADPH:quinone reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02817: zinc-binding alcohol dehydrogenase family protein
  • amino acids 12 to 333 (322 residues), 532.6 bits, E=2.4e-164
• PF08240: ADH_N
  • amino acids 32 to 89 (58 residues), 24.4 bits, E=3.4e-09
• PF00107: ADH_zinc_N
  • amino acids 157 to 263 (107 residues), 41 bits, E=2.8e-14
• PF13602: ADH_zinc_N_2
  • amino acids 190 to 330 (141 residues), 63.4 bits, E=6.7e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1084)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

See D8J1I0 at UniProt or InterPro

Protein Sequence (333 amino acids)

>HSERO_RS05430 NADPH:quinone reductase (Herbaspirillum seropedicae SmR1)
MKAILTQPQSPLISAPDALIETTLPDPTPGEHDLLVEVKAISVNPVDTKIRASAKEARVL
GWDVSGVVRAVGPAVTLFAPGDEVFYAGSITRPGANSELHVVDERIVGRKPSSLGHADAA
AIPLTAITAWELLFDRVAVAEGGGQGQHLLIIGAAGGVGSMLTQLARKLTQLTVIGTASR
PETAHWVGELGAHHVIDHSQPLKPQLEKLGIPEVGIVISLTHTDQHYAQIIDVLAPQGQL
ALIDDPASLDAMPLKRKSISLHWELMFTRSMFQTPDMIRQHELLQRVSQLLDQGVLRTTT
GEHYGRIDAANLRRAHGLLESGKAKGKIVLEGF