Protein Info for HSERO_RS05320 in Herbaspirillum seropedicae SmR1

Annotation: ribonucleotide-diphosphate reductase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 PF00005: ABC_tran" amino acids 17 to 167 (151 residues), 113.3 bits, see alignment E=1.4e-36 amino acids 274 to 425 (152 residues), 60.3 bits, see alignment E=3.5e-20

Best Hits

Swiss-Prot: 66% identical to RBSA2_BURCM: Ribose import ATP-binding protein RbsA 2 (rbsA2) from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to hse:Hsero_1063)

Predicted SEED Role

"D-xylose transport ATP-binding protein XylG" in subsystem Xylose utilization

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J125 at UniProt or InterPro

Protein Sequence (502 amino acids)

>HSERO_RS05320 ribonucleotide-diphosphate reductase subunit alpha (Herbaspirillum seropedicae SmR1)
MLQLTGIKKNFGPVTVLRGVDLEVRAGEVHALLGENGAGKSTLMKILCGIVRPDAGEIRI
DGQPCRFDSYRAAIAGGVGVVFQEFSLIPYLDAVDNMFLARELRSRWGWLQRAAMRRRAQ
EIIGQLGVAIPLDVPVCKLSVAQQQFVEIAKALALDARILVLDEPTATLTPAEVEHLFAV
MRSLRAQGVAIIFISHHLEEIFEICDRITVLRDGAYVATCATAEVDQARLVEMMVGRRIE
NCFPPKPAKGGEGEGEVVLEVHALQLRRQAPVSQFQLRRGEILGFAGLVGSGRTETVLAM
LGAHAALSCKLSMHGVPLRFADPAQALQAGIGLLPESRKEQGLITSFSILHNVSLNNYGK
YRLGGLFLDRRREQQATEAAMQRVRVKAPGAQVRVDTLSGGNQQKVVIARWINHAMKVLI
FDEPTRGIDVGAKSEIYQLMREFTAQGYSILMISSELPEVVGMADRVCVFRGGGIVATLE
GEAVNAEEIMTHATTGRIRHAA