Protein Info for HSERO_RS05255 in Herbaspirillum seropedicae SmR1

Updated annotation (from data): ABC transporter for L-fucose, permease component
Rationale: Specifically important for L-fucose utilization.
Original annotation: ribose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 37 to 57 (21 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 273 to 290 (18 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 323 to 341 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 63 to 336 (274 residues), 150.1 bits, see alignment E=3.4e-48

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to hse:Hsero_1050)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J112 at UniProt or InterPro

Protein Sequence (347 amino acids)

>HSERO_RS05255 ABC transporter for L-fucose, permease component (Herbaspirillum seropedicae SmR1)
MANNIHSATSASTTMANTASAQGLRARLFNPAARQKLLAFASLLLMILFFSFASPNFMEV
DNLVSILQSTAVNGVLAIACTYVIITSGIDLSVGTMMTFCAVMAGVVLTNWGMPLPLGIA
AAIFFGALSGWISGMVIAKLKVPPFIATLGMMMLLKGLSLVISGTRPIYFNDTEGFSAIA
QDSLIGDLIPSLPIPNAVLILFLVAIGASIILNKTVFGRYTFALGSNEEALRLSGVKVDF
WKVAVYTFSGAICGIAGLIIASRLNSAQPALGQGYELDAIAAVVIGGTSLSGGTGTILGT
IIGAFIMSVLVNGLRIMSVAQEWQTVVTGVIIILAVYLDILRRRRRA