Protein Info for HSERO_RS05250 in Herbaspirillum seropedicae SmR1

Updated annotation (from data): ABC transporter for L-fucose, ATPase component
Rationale: Specifically important for L-fucose utilization.
Original annotation: D-ribose transporter ATP binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 PF00005: ABC_tran" amino acids 38 to 189 (152 residues), 108 bits, see alignment E=6.3e-35 amino acids 290 to 443 (154 residues), 72.2 bits, see alignment E=7.1e-24

Best Hits

Swiss-Prot: 81% identical to RGMG2_BURCH: Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 (Bcen2424_5039) from Burkholderia cenocepacia (strain HI2424)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to hse:Hsero_1049)

MetaCyc: 45% identical to D-galactose/methyl-galactoside ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-18-RXN; TRANS-RXN0-541

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J111 at UniProt or InterPro

Protein Sequence (520 amino acids)

>HSERO_RS05250 ABC transporter for L-fucose, ATPase component (Herbaspirillum seropedicae SmR1)
MQEDKETSTTGVAASSSSSVPVIALRNVCKRFPGVLALDNCQFELAAGEVHALMGENGAG
KSTLMKILSGVYQRDSGDILLDGKPVEITEPRQAQALGIGIIHQELNLMNHLSAAQNIFI
GREPRKAMGLFIDEDELNRQAAAIFARMRLDMDPSTPVGELTVARQQMVEIAKALSFDSR
VLIMDEPTAALNNAEIAELFRIIRDLQAQGVGIVYISHKMDELRQIADRVSVMRDGKYIA
TVPMQETSMDTIISMMVGRALDGEQRIPPDTSRNDVVLEVRGLNRGRAIRDVSFTLRKGE
ILGFAGLMGAGRTEVARAIFGADPLEAGEIIIHGGKAVIKSPADAVAHGIGYLSEDRKHF
GLAVGMDVQANIALSSMGRFTRVGFMDQRAIREAAQMYVRQLAIKTPSVEQQARLLSGGN
QQKIVIAKWLLRDCDILFFDEPTRGIDVGAKSEIYKLLDALAEQGKAIVMISSELPEVLR
MSHRVLVMCEGRITGELARADATQEKIMQLATQRESAVAS