Protein Info for HSERO_RS05210 in Herbaspirillum seropedicae SmR1

Updated annotation (from data): L-arabinose 1-dehydrogenase (EC 1.1.1.46)
Rationale: Specifically important in carbon source L-Arabinose. Similar to characterized L-arabinose 1-dehydrogenases such as B8H1Z0.
Original annotation: 3-oxoacyl-ACP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00106: adh_short" amino acids 19 to 210 (192 residues), 161.6 bits, see alignment E=2.6e-51 PF01370: Epimerase" amino acids 21 to 128 (108 residues), 22.9 bits, see alignment E=7.8e-09 PF13561: adh_short_C2" amino acids 28 to 260 (233 residues), 178.7 bits, see alignment E=2.2e-56

Best Hits

Swiss-Prot: 53% identical to XDH_CAUVN: D-xylose 1-dehydrogenase (xylB) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_1041)

Predicted SEED Role

"Putative oxidoreductase in arabinose utilization cluster" in subsystem L-Arabinose utilization

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J103 at UniProt or InterPro

Protein Sequence (261 amino acids)

>HSERO_RS05210 L-arabinose 1-dehydrogenase (EC 1.1.1.46) (Herbaspirillum seropedicae SmR1)
MSNTPQNVQLASFPSLKGKRVFITGGGTGIGAAIVEAFAQQGAHVAFVDIATEASEALCN
EVAAAGHPKPLFRHCDLRDIPAFQATIAELQAQLGDFDVLVNNAANDQRHKLEEVTLEYW
NDRIAINQRPSFFAVQSVVEGMKRRGGGSIINFSSISWHQSGGGFPVYTTAKASTLGLTR
GLARDLGPHKIRVNTVTPGWVMTERQIKLWLDEEGKKAIARNQCLQGDLLPWHLARMVLF
LAADDSAMCTAQEFIVDAGWV