Protein Info for HSERO_RS05120 in Herbaspirillum seropedicae SmR1

Annotation: deoxyribose-phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 62% identical to DEOC_MOUSE: Deoxyribose-phosphate aldolase (Dera) from Mus musculus

KEGG orthology group: K01619, deoxyribose-phosphate aldolase [EC: 4.1.2.4] (inferred from 100% identity to hse:Hsero_1023)

Predicted SEED Role

"Deoxyribose-phosphate aldolase (EC 4.1.2.4)" in subsystem Deoxyribose and Deoxynucleoside Catabolism (EC 4.1.2.4)

MetaCyc Pathways

2-deoxy-D-ribose degradation I (2/3 steps found)
2-deoxy-α-D-ribose 1-phosphate degradation (1/3 steps found)
superpathway of purine deoxyribonucleosides degradation (2/7 steps found)
superpathway of pyrimidine deoxyribonucleosides degradation (1/6 steps found)

KEGG Metabolic Maps

Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J0Y5 at UniProt or InterPro

Protein Sequence (343 amino acids)

>HSERO_RS05120 deoxyribose-phosphate aldolase (Herbaspirillum seropedicae SmR1)
MNMTRKTPSLRSAQGEADVAQPDSAPTGHPRNSVQAYDAAAFEHLRINLSAAEKRVATLK
GRRSVKKDAQAAWLLKAITCIDLTTLSGDDTPQRVRRLCAKAANPLRADLLEALGMQDRG
LTTGAVCVYHRFVKTAVDALEGKGIPVAAVSTGFPAGLNPHALKLKEIEASVRDGAAEID
IVITREHVLTGNWEALYREMRDFRQACGEAHVKAILATGELKTLRNVAKASMVCMMAGAD
FIKTSTGKESVNATPLVSLVMLRMIRQYQEMTGIKVGYKPAGGVATAKDVLEYQVLMKEE
LGHDWLQPDLFRVGASSLLADIERQLEHHVTGRYSAFNRHAIG