Protein Info for HSERO_RS05100 in Herbaspirillum seropedicae SmR1

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 50 to 67 (18 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 251 to 268 (18 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 43 to 315 (273 residues), 97.1 bits, see alignment E=5.1e-32

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to hse:Hsero_1019)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J0Y1 at UniProt or InterPro

Protein Sequence (337 amino acids)

>HSERO_RS05100 sugar ABC transporter permease (Herbaspirillum seropedicae SmR1)
MTMKLKISDPQLLFLLVINVAILLVATVFSHGDFLDIYNFQSMASQLPELGLLAIGVALA
MISGNGGIDLSGIGLANLAGVVAAAAMPLLVAAPDAAPWTYTLGFIAVALVTGLLGGALN
GWLISRGNLTPILCTLGTQMIFTGLAVVLTNGSSLRISVVDPISAIGNESVLGVPIPFII
FVALLLLVGWLMRYSLFGIKLYLLGTNARAARYAGISQNRLRFATYVISGVLASVAGIII
AARTASVKADYGNSYLLIAILIAVMAGVRPQGGYGRMVCLFFSALALQLLSSTFNLLEIS
NFFRDCAWGLLLLCFLASARVSWRDFFPNSKAQLRKS