Protein Info for HSERO_RS05085 in Herbaspirillum seropedicae SmR1

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 35 to 61 (27 residues), see Phobius details amino acids 72 to 102 (31 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details amino acids 325 to 343 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 61 to 337 (277 residues), 121.5 bits, see alignment E=1.8e-39

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to hse:Hsero_1016)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J0X8 at UniProt or InterPro

Protein Sequence (347 amino acids)

>HSERO_RS05085 sugar ABC transporter permease (Herbaspirillum seropedicae SmR1)
MDASTLTRQAADASTDAPVQRRPSLAALLKKNPSAFTLLLIVLVVLTVALINPAFFQLAV
LFDIVRACTTLGLFALGVMIVLAAGGIDVSFAAIAALTMYSITKVVMTWFPETHIAVILL
AGAVGGAGLGVLNGLLVDWLKAPSLIVTIGTQYLYRGILLTFVGTVFFMNIPHAMDSFGK
LTLARHDTANGLHAVLPATVLVLVLASVLTWWLLNRTLMGRAVYAVGGSLAIAERLGYKL
RSVHLFVFGYAGFLSGLAGIVHVSSTRLANPFDLVGSELDVIAAVVLGGARITGGHGSVM
GTLLGVLLVTLINNVLILAGVPSTWQKAIIGGFIVLAGAVFALRREK