Protein Info for HSERO_RS04960 in Herbaspirillum seropedicae SmR1

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 122 to 146 (25 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 247 to 264 (18 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details amino acids 349 to 368 (20 residues), see Phobius details amino acids 374 to 400 (27 residues), see Phobius details amino acids 421 to 440 (20 residues), see Phobius details amino acids 446 to 467 (22 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 31 to 437 (407 residues), 240 bits, see alignment E=2.5e-75 PF07690: MFS_1" amino acids 35 to 426 (392 residues), 178.6 bits, see alignment E=1.8e-56 PF00083: Sugar_tr" amino acids 41 to 134 (94 residues), 26.4 bits, see alignment E=3.3e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0990)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J0V2 at UniProt or InterPro

Protein Sequence (478 amino acids)

>HSERO_RS04960 major facilitator transporter (Herbaspirillum seropedicae SmR1)
MSCPSTPAAAALAAHPPAAGATLTPRAGMLPLVALAIGFVMAMLDVTVVNVGLSNIAGSL
DAPLSTLVWIVDGYTLTFAAMLLVGGALADRFGARRLYLTGLFLFVLASLLCGAAPNGPF
LIVARLLQGLGAAFFMPSSLSLLTHVYEDDRVRARMLGVWSATVGLAAAVGPLVGGVLIH
WLGWRSVFLINVPVGLVGLVMARKLIPQVGGHARALNLSSHLAGVVMLAGLSFVLIQGPV
YGWTSPRILAGLAVALSAGAALIRHELRGIAPLLPKALFATPQFAAANGIGFLINFGVYG
NLFYLALFLQQGRGADALQTGLQLVPMMAVIFFGNLMSGRMSAHWGPRVPLLLGLSVGTV
FTALAMGFSPATPYWLLALVCASANLGISTAIPAMTTVVMQVAGKAHANSAAAALNANRQ
IGALVGVALMGAILHSVTGWNLRNPLAFGVMAAGYASALWLVWRFVGVVKEQWQVRRA