Protein Info for HSERO_RS04910 in Herbaspirillum seropedicae SmR1

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 623 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 4 to 313 (310 residues), 97.9 bits, see alignment E=6.3e-32 PF19040: SGNH" amino acids 392 to 608 (217 residues), 135.9 bits, see alignment E=2e-43

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0981)

Predicted SEED Role

"O-antigen acetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J0U3 at UniProt or InterPro

Protein Sequence (623 amino acids)

>HSERO_RS04910 acyltransferase (Herbaspirillum seropedicae SmR1)
VLSVVVFHAFPEWLPGGFVGVDIFFVISGFLISGILFDALQRDRFSIVDFYIRRIRRIFP
ALLLVMLACLLAGWFILLPEEYRQLGKHLLGGAGFVSNIVLWNEAGYFDTSAETKPLLHL
WSLGVEEQFYLFWPLMLWAAWRRRTGMLAVLLGVMALSFGWNIVWLHRDAVAAFYLPMSR
FWELGAGALLAWRHRQGAVPTSVQAHRLSVAGLLLIVVAIATITKDDAFPGWWALLPVTG
AVLLLAAGPQARINRSLLSHRTMVWVGLISYPLYLWHWPLLAFARLVVGATPSVQLRLAA
VALALLLAWLTYRLVELPVRLRSAGHRSAVTLALLMALMAALGGYVVKRNGMDFRQLGAV
AMLFNDQVKETAVLNHFELPHPSCAALMGQEHSRDWCAAPVSAEPPQVLLIGDSYSGAYA
PMLARLYQASPQPQLVFQQFARGGCASLLDGGGGYCGEISERVAAYARQTPSIKTVVLAA
NWPGHIAANPKGVLKALEHTILYYRQLGKRVVVLLSPPNGANPKSCVLRGIRLSDADFCN
LPRAKAEQMDDHYRDLMLPLLQRLDVPVFDPYPTLCDEHGCKVIDGPRILYFDPGHLSAY
GAQYLADHAGDALRRLLLGTPAH