Protein Info for HSERO_RS04830 in Herbaspirillum seropedicae SmR1

Annotation: alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF08240: ADH_N" amino acids 29 to 135 (107 residues), 109.5 bits, see alignment E=7.6e-36 PF00107: ADH_zinc_N" amino acids 179 to 302 (124 residues), 113.1 bits, see alignment E=8.8e-37

Best Hits

Swiss-Prot: 82% identical to ADHA_RHIME: Alcohol dehydrogenase (adhA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K13953, alcohol dehydrogenase, propanol-preferring [EC: 1.1.1.1] (inferred from 100% identity to hse:Hsero_0964)

MetaCyc: 67% identical to furfuryl alcohol dehydrogenase (Cupriavidus pinatubonensis JMP134)
Alcohol dehydrogenase. [EC: 1.1.1.1]; 1.1.1.- [EC: 1.1.1.1]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J0S6 at UniProt or InterPro

Protein Sequence (341 amino acids)

>HSERO_RS04830 alcohol dehydrogenase (Herbaspirillum seropedicae SmR1)
MTQMMKAAVVREFGKPLSIEQVPVPTPAPGQILVKFEASGVCHTDLHAAHGDWPVKPTPP
FIPGHEGTGYVAAVGAGVKHVKEGDRVGVPWLHTACGCCSPCRTGWETLCAEQQNTGYSV
NGSFAEYGLADPKFVGHLPDNLDFGPAAPVLCAGVTVYKGLKETEVRPGEWVVISGIGGL
GHMAVQYAKAMGMHVVAADIHEDKLALAKKLGADLTVDGRNHNAVAEVQRIIGGAHGALV
TAVSPKAMEQAFGFLRARGTMALVGLPPGDISLPVFNTVLKRITVRGSIVGTRQDLEESL
VFAAEGKVAAHFTWDKLDNINAIFARMEEGKIDGRIVLDLK