Protein Info for HSERO_RS04335 in Herbaspirillum seropedicae SmR1

Annotation: sodium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 232 to 263 (32 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details amino acids 303 to 328 (26 residues), see Phobius details amino acids 340 to 358 (19 residues), see Phobius details amino acids 370 to 394 (25 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 27 to 393 (367 residues), 86.4 bits, see alignment E=9.6e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0863)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J044 at UniProt or InterPro

Protein Sequence (402 amino acids)

>HSERO_RS04335 sodium:proton antiporter (Herbaspirillum seropedicae SmR1)
MEWALPSFTLAQTLQWNALLVFGGLLLFGLIAGYVVSKSPWVPRITGYLLVGFLLGSGGF
NLLSGEVLKVTNIFADIAVALVVYQLGRYVDIGWLRREKWLMITVAVSAVLCFGFVSIAL
TWFGTDSVMALLGGVMAIATAPAVVLVVLRDLKAEGQVTRRLAAMTALNNFVAVLAAYAL
LPVIAHEAGTPVWTLIQHTLYSLVGSAILAYLTYWLMMPLARLLGRENSSQFVLVISVIA
LAIGVAHALHLPVMLTMLIFAILSKNLDRQFDLMELEFGVANELFVVMLFVTVGASMKLS
DLGLLGFSVLILIAARFLAMGLGIFLFARFARMNWRQAGLLTLGTLPMTEVGVGLMQTVS
SLYPHTTANVLPLLAGSMVVLEFLGPVATQFALIKSGESGRE