Protein Info for HSERO_RS04295 in Herbaspirillum seropedicae SmR1

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 706 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 41 to 67 (27 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details PF03707: MHYT" amino acids 51 to 108 (58 residues), 24.2 bits, see alignment 4.2e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 260 to 422 (163 residues), 161.3 bits, see alignment E=8.8e-52 PF00990: GGDEF" amino acids 262 to 418 (157 residues), 173.1 bits, see alignment E=6.1e-55 PF00563: EAL" amino acids 438 to 674 (237 residues), 237.5 bits, see alignment E=2.1e-74

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_0855)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8J036 at UniProt or InterPro

Protein Sequence (706 amino acids)

>HSERO_RS04295 diguanylate cyclase (Herbaspirillum seropedicae SmR1)
MSGSFHFLLLAFAVLVASLSAYAALEVSERMVMQESQHRRLWLSVGAVVLGLGVWATLFL
TVAALGLSMPVGFDIRLTVLALLLCLGSAFYLMHLSGLRRPHPSRLAIGGLSIGAAINAA
FHMALAAMQLLPALLYQQVLLGLALLLTELIGVFIVALFSASNGRKPKAGSLNSQQTRRV
LAALLVGLGLVAAATAGLRALVIAPHTQSLAVASLLREHLVNGIVFLAFLAMALALVISG
VQRNQVLKRIVGRTNDKLLHFATHDVLTGLPNRALLADRIQHAVEVARRNGKTFAVLFMD
LDGFKAINDSLGHAVGDGLLVAVAQRIRQCLRGEDMVARIGGDEFVVVVGNLSSPDVVEQ
LSENILAALRQDFQIDDATLRVTSSIGIAVYPNSGDSVDALMKNADAAMYEAKQSGRNTY
RFFEPAMHASAMRHLQVRQALQQAIDEQQFRLHFQPKYRGASKELTGLEALLRWTHPQLG
EMAPTEFIPIAERSGQILCIGDWVLQAVCEQIARWDAAGMKPVKVALNLSPLQMRTDLVA
RIVELVGAAGIAPQRLMFEITETAAMKDVERSQRVIGELQALGFDIAIDDFGTGYSSLAY
LAQFHCRQIKIDRFFTSRLDGDDHSGRAIVAAIIALAHALQMEVVAEGVETEGQLRELQL
LHCDQVQGFLLGRPAEAPSVPGLVQASNDDLFGAAAGASAVLKLER